Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0271 proteasome-activating nucleotidase 
MSGDFDTIRDASSPDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNL
VVNIASHIDQKLIKPGISVALNQRGSTILEVLPQKEDPIVKTMEIIERPNVTYSEIGGLEEQIRELREVVELPLKNPEIF
REIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIG
AKRIDIGTSGEREIQRTLMQLLAELDGFDPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFKGRTEIFNIYLKK
MKIEDNINLELLSQLTEGFSGADIKNVCVEAAYMAIRDGRNKVTMNDLVEAINKINVKRNKMESMKERREKYS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897214 Gene name: - COG: O COG1222 ATP-dependent 26S proteasome regulatory subunit Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0271 hypothetical 1 Proteasome regulatory AAA family ATPase (26S protease regulatory subunit 4), putative Proteases 1 multifunctional Belongs to AAA ATPases family 82 % similar to Aeropyrum pernix AP2 2012 Cell division 04/22/01 00:00:00 terminal status:check: MH O COG1222 Posttranslational modification, protein turnover, chaperones ATP-dependent 26S proteasome regulatory subunit

CROSS REFERENCES:
pI: 5,13
MW: 44141,79
GenBank: 13813411
SCOP superfamily: => 
SCOP assignment: 126-357 3.1e-65 P-loop containing nucleotide triphosphate hydrolases