Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0292 hypothetical protein SSO0292 
MRTQGELTLPGEELAVIEEFMTGDGTYEQNGIVRAAVVGKIFYDMLNRKSNVLGFKKIIFQHLKKAKYVIGIVNSIKEDS
ALVSIVGIEERGLASPISAYLHISQISNKKINNVTDAIKIGDVIKAKLLSYTFPLALTIKMKDLGVIYARCSRCGYLLIK
QDENNLKCQRCGNIEQRKIGSYMVKKGGN

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897237 Gene name: - COG: J COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0292 hypothetical 1 Conserved hypothetical protein 1 single function Similarity with APE0445, PAB2314, MTH1318, PH0043, AF0206 04/22/01 00:00:00 terminal status:good J COG1096 Translation, ribosomal structure and biogenesis Predicted RNA-binding proteins (consist of S1 domain and C4 Zn-finger domain)

CROSS REFERENCES:
pI: 10,17
MW: 21003,5
GenBank: 13813436
SCOP superfamily: => 
SCOP assignment: 61-131 4.0e-06 Nucleic acid-binding proteins