Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0298 Thiamine biosynthesis protein related protein (thiF) 
MSNSSIDIGVPSLPPPFSIGTISIPTFSRQHLFLKIILHYNLVERYSRQLIVLGLGIQQRLNELKILIAGCGALGTAVAE
LLARLGVKELTIVDADVVDITNLHRVHLFDENDVGKPKAEVCAKKISLINSSIKINYIIDILDEENVERLISDKDYVFDA
LDSLYYKLLLNDAIVKLGKILIYGGINGEYGSAKLIDPSQTSCLSCFIDYSDQDEIGNSCDVIGTTPLIVELTATLQVNL
MLNHLRGNPDYSLFYIDSRELKIERINIEKNSQCKTCVLNEYPFLYQKISKPKCGIFRTNMKIPELDEPKVFKNLGNVTL
CYPSIGCFEKRGR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897242 Gene name: thiF COG: H COG0476 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0298 hypothetical 1 thiF Thiamine biosynthesis protein related protein Cofactor Biosynthesis 1 single function Thiamine 04/22/01 00:00:00 terminal status:good H COG0476 Coenzyme metabolism Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2

CROSS REFERENCES:
pI: 6,07
MW: 37278,85
GenBank: 13813443
SCOP superfamily: => 
SCOP assignment: 65-215 6.2e-09 NAD(P)-binding Rossmann-fold domains