Sulfolobus solfataricus P2 >SSO0312 Benzene 1,2-dioxygenase system ferredoxin component, putative MEYIRISRTDFKTGEKRKIILPNGRELVVFYLGVDRFFVFDNKCPHLGCDLSKYGVIIKEELVCQCHFSHFSIYSGEPKK GASKKPIKVYRVQVTKDEVVISLI15897253 Gene name: - COG: PR COG2146 Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2 __________
|
|
CROSS REFERENCES: pI: 9,71 MW: 12044,09 GenBank: 13813454 SCOP superfamily: => SCOP assignment: 3-103 6.1e-16 ISP domain