Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0312 Benzene 1,2-dioxygenase system ferredoxin component, putative 
MEYIRISRTDFKTGEKRKIILPNGRELVVFYLGVDRFFVFDNKCPHLGCDLSKYGVIIKEELVCQCHFSHFSIYSGEPKK
GASKKPIKVYRVQVTKDEVVISLI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897253 Gene name: - COG: PR COG2146 Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0312 hypothetical 1 Benzene 1,2-dioxygenase system ferredoxin component, putative Cellular Processes 1 single function Detoxification 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 9,71
MW: 12044,09
GenBank: 13813454
SCOP superfamily: => 
SCOP assignment: 3-103 6.1e-16 ISP domain