Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0353 30S ribosomal protein S19e 
MSLIMITAEMVPPDLLIKRLAIYLKENVKTVDPPEWALLAKTASFKERVPDNAEDWWYIRAASLLRKLYVNSIIGIEKTR
TIYGGRKRRGTRPEKFVKAPGHVNRLIFQQLEKAGLVQKIKNKGRSLSPKGRSLLDKLALEIFKELAENNTSLKVYLE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897290 Gene name: rps19E COG: J COG2238 Ribosomal protein S19E (S16A) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0353 hypothetical 1 rps19E SSU ribosomal protein S19E Translation 13 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2238 Translation, ribosomal structure and biogenesis Ribosomal protein S19E (S16A)

CROSS REFERENCES:
pI: 10,84
MW: 18118,2
GenBank: 13813499