Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0367 ABC transporter, ATP binding protein 
MIEVYVKKKLQAFLLNVNFSEKGIIAITGKNGSGKSTLLNVIAGILKPDEGYIRLNDIDITNLPINKRNVILVTPDSYIP
TLDLKKHLTWGAKLRGRKVNDKEVMEVAKLLGVPNENKKVGNLSLGNREKVSLATAILTKPNLILVDEGFSNISEKEYFI
NIYTDLCKKNQIDLIYVTQDTEDAKFSDHHYVMNNGSLHKVF

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897302 Gene name: - COG: G COG3839 ABC-type sugar transport systems, ATPase components Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0367 hypothetical 1 ABC transporter, ATP binding protein Transport single function 04/22/01 00:00:00 terminal status:check: MH P COG1118 Inorganic ion transport and metabolism ABC-type sulfate/molybdenum transport system, ATPase component

CROSS REFERENCES:
pI: 9,88
MW: 22685,17
GenBank: 13813513
SCOP superfamily: => 
SCOP assignment: 15-198 1.8e-33 P-loop containing nucleotide triphosphate hydrolases