Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0375 XerC/D integrase-recombinase protein (xerC/D) 
MKLDLGSPPESGDLYNAFINALIIAGAGNGTIKLYSTAVRDFLDFINKDPRKVTSEDLNRWISSLLNREGKVKGDEVEKK
RAKSVTIRYYIIAVRRFLKWINVSVRPPIPKVRRKEVKALDEIQIQKVLNACKRTKDKLIIRLLLDTGLRANELLSVLVK
DIDLENNMIRVRNTKNGEERIVFFTDETKLLLRKYIKGKKAEDKLFDLKYDTLYRKLKRLGKKVGIDLRPHILRHTFATL
SLKRGINVITLQKLLGHKDIKTTQIYTHLVLDDLRNEYLKAMSSSSSKTPP

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897309 Gene name: xerC/D COG: L COG0582 Integrase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0375 hypothetical 1 xerC/D XerC/D integrase-recombinase protein Replication and Repair 1 single function 04/22/01 00:00:00 terminal status:good L COG0582 DNA replication, recombination and repair Integrase

CROSS REFERENCES:
pI: 10,86
MW: 33539,08
GenBank: 13813520
SCOP superfamily: => 
SCOP assignment: 13-101 5.8e-06 lambda integrase-like, N-terminal domain
SCOP assignment: 113-278 2.9e-43 DNA breaking-rejoining enzymes