Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0400 riboflavin synthase subunit beta 
MQEKSIRLGIVVAEFNYDITQLMLQKALSHARFLNVEVKVVIKVPGTFDMPLAIKKLLEKDFIDAVVTLGAVIKGETKHD
ELVASQTARKIVDLSTEFNKPVTLGIIGHGATHEQAVERIEEYATRAVEAAIKLVQRTRKLDELKEIKETVIIE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897334 Gene name: ribH COG: H COG0054 Riboflavin synthase beta-chain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0400 hypothetical 1 ribH Riboflavin synthase beta chain (6,7 dimethyl 8-ribityllumazine synthase) (DMRKL synthase) Cofactor Biosynthesis 1 single function 2.5.1.9 Also close hit to riboflavin synthase beta subunit Riboflavin 04/22/01 00:00:00 terminal status:good H COG0054 Coenzyme metabolism Riboflavin synthase beta-chain

CROSS REFERENCES:
pI: 6,98
MW: 17247,07
GenBank: 13813551
SCOP superfamily: => 
SCOP assignment: 4-146 8.1e-35 beta-subunit of the lumazine synthase/riboflavin synthase complex