Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0408 30S ribosomal protein S15 
MNKRRAKGKSHSIRPARAGAPKWVRLTREEVEMLVEELAKRGYTPSMIGIILRDQYGIPLVKQIVGKKVTQILEERGLAP
QIPEDLFNLIRKAVNVRRHINEYPRDKTAKKGLEEIESKIRRLTRYYKGIGKLPQEWVYDPAKAELLVAGAS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897342 Gene name: rpS13E COG: J COG0184 Ribosomal protein S15P/S13E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0408 hypothetical 1 rpS13E SSU ribosomal protein S13E Translation single function Close hits to several plant species' 40S ribosomal protein Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0184 Translation, ribosomal structure and biogenesis Ribosomal protein S15P/S13E

CROSS REFERENCES:
pI: 10,96
MW: 17441,33
GenBank: 13813561
SCOP superfamily: => 
SCOP assignment: 64-150 8.9e-16 S15/NS1 RNA-binding domain