Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0411 30S ribosomal protein S6 
MPDFKIVISDPQSVEPKRIKVKVKASDQVKSITGEKDGKAVPQAKVNEKTKQLLNVDTLLTLEITKQEGDKKVKVKGHFK
VDVDNSVPDNEVWISKTMAEKFGAEDFEAFAYRTKTLQISVDQNKATNLVGLKIGDVFEANQLIGLPVKLKITGGSDNSG
FPMRFDVIGAAKRKILLSGPPGFYPNENGERRRKTIRGNTISQEIVQINTIIVR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897344 Gene name: rps6E COG: J COG2125 Ribosomal protein S6E (S10) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0411 hypothetical 2 rps6E SSU ribosomal protein S6E Translation single function Hit to one end of protein, other domains not recognized Ribosomal Proteins 04/22/01 00:00:00 terminal status:normal J COG2125 Translation, ribosomal structure and biogenesis Ribosomal protein S6E (S10)

CROSS REFERENCES:
pI: 10,38
MW: 23720,26
GenBank: 13813563