Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0425 30S ribosomal protein S25e 
MGGASKKPISTMEKRLKKEAEKQQKAEEKKKGPSKTGKEIISRAVTIDEETKKKVLDEIKKESIITPYALATKSGISISV
ARKILKELENQNVVKLYSKNRRLEIYIAAS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897354 Gene name: rps25E COG: J COG4901 Ribosomal protein S25 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0425 hypothetical 3 rps25E SSU ribosomal protein S25E Translation ambiguous Ribosomal Proteins 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 10,7
MW: 12345,39
GenBank: 13813575
SCOP superfamily: => 
SCOP assignment: 50-107 4.9e-06 "Winged helix" DNA-binding domain