Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0435 SSU ribosomal protein S24E (rps24E) 
MESQAKVKISDKAEGIIERDMQNSVIGRREISLKVYHMGSGTPSRKDIIKAIIQALGSQENLVVVRKISTSYGAGISNVK
LHIYKSREILEKVEPKYLLDRDAGTKQKKGGSKGGQGAKG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897365 Gene name: rps24E COG: J COG2004 Ribosomal protein S24E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0435 hypothetical 1 rps24E SSU ribosomal protein S24E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2004 Translation, ribosomal structure and biogenesis Ribosomal protein S24E

CROSS REFERENCES:
pI: 10,72
MW: 13097,08
GenBank: 13813588