Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0439 tRNA splicing endonuclease 
MVKALLVGSKVLVPSIDESRYLYSNGFYGKPIGISKPKGPKDIVRPLELSLIESVYLTKKGLINVVDKNGDLLEYKKLYE
YSAMKINKFEILYKVYEDLREKGFIVRSGVKYGADFAVYTLGPGLEHAPYVVIAVDIDEEITPHELLSFGRVSHSTKKRL
VLALVDRKSEGIRYIMFKWVKM

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897369 Gene name: - COG: J COG1676 tRNA splicing endonuclease Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0439 hypothetical 1 tRNA intron endonuclease, putative Translation 16 single function 3.1.27.9 M.jannaschii homolog Translation factors 04/22/01 00:00:00 terminal status:good J COG1676 Translation, ribosomal structure and biogenesis tRNA splicing endonuclease

CROSS REFERENCES:
pI: 10,18
MW: 20710,21
GenBank: 13813592
SCOP superfamily: => 
SCOP assignment: 87-181 9.5e-26 tRNA splicing endonuclease, C-terminal domain
SCOP assignment: 2-81 3.6e-08 tRNA splicing endonuclease, N-terminal domain