Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0461 hypothetical protein SSO0461 
MIIIVTGTPGVGKTVASKKLSEALNLNYLSLSQFVIENKLYTEYDELRQSYIIDEDKVKEELEKIISTSHLVIETIYPSL
VSTADLVVVLRKNPFSLYNELKGRGWADIKVAENVEAEILGVISQEAREAFKDKVCEVDTTEMSTEQILNKILNKQCDGP
IEWLVDTKVQRFLEELDKIISSYENDI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897390 Gene name: - COG: F COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0461 hypothetical 1 Conserved hypothetical protein 1 hypothetical 04/22/01 00:00:00 terminal status:good F COG1936 Nucleotide transport and metabolism Predicted nucleotide kinase (related to CMP and AMP kinases)

CROSS REFERENCES:
pI: 4,45
MW: 21247,11
GenBank: 13813617
SCOP superfamily: => 
SCOP assignment: 1-154 4.5e-11 P-loop containing nucleotide triphosphate hydrolases