Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0627 Methionyl-tRNA synthetase N-term homolog (metS-like) 
MVFPSEILLTSITTILHNRYKKLASNKYKLLLHYVNQNPYNSSPMLNIMSNQITIDDFAKLDLKVGIVRQAERIEGTRLL
KLLIDLGSEQRQIIAGLGEYYTPEELLNKRIIVIANLKPRVIRGFESQGMLLAAGCKEDEAKGIKPRILTVDGEVPPGTK
IC

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897541 Gene name: metS-like COG: R COG0073 EMAP domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0627 hypothetical 1 Methionyl-tRNA synthetase N-term homolog Translation 1 single function 6.1.1.10 metS Aminoacyl tRNA synthetases 04/22/01 00:00:00 terminal status:good R COG0073 General function prediction only EMAP domain

CROSS REFERENCES:
pI: 9,92
MW: 18220,25
GenBank: 13813794
SCOP superfamily: => 
SCOP assignment: 57-162 3.4e-22 Nucleic acid-binding proteins