Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0675 Molybdopterin-guanine dinucleotide biosynthesis protein B (mobB) 
MACIFHIIGKKDTGKTSVIESVLREIKKDNLKVAVVKHSHHKLDLAGKDTYRYRNSGSDLILFQEGEEESVLFMPSVSSL
TLITLLPVDVILVEGFSNVDIGKKYIINNVNEVEAISKQVINDIKKECQKTNRALILDNVKVEVTSDNALLLTLYNLMKV
LGVKNVSSD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897582 Gene name: mobB COG: H COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0675 hypothetical 1 mobB Molybdopterin-guanine dinucleotide biosynthesis protein B Cofactor Biosynthesis 1 single function Molybdopterin 04/22/01 00:00:00 terminal status:good H COG1763 Coenzyme metabolism Molybdopterin-guanine dinucleotide biosynthesis protein MobB

CROSS REFERENCES:
pI: 7,51
MW: 18827,74
GenBank: 13813841
SCOP superfamily: => 
SCOP assignment: 4-114 1.9e-05 P-loop containing nucleotide triphosphate hydrolases