Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0678 hypothetical protein SSO0678 
MKICVLYSGGKDSTYALHWAVFKGFEVVCLITLIPKREDSWMFQYPNVIYTKYQAEAMDFKLITFGTSGEKDKELEDLKK
ALLQAKNEGADGIVSGALLSDYQRLNISIIAEELGLKTYTPLWRKSQEEYMRWLVKEGFKFIITSASAYGFPFDLVGKEI
TTEDVEKIIERARRYGFNPAFEGGEAETFVTYAPLFKTQLRVNGKLKRISEYECRYEITDIH

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897585 Gene name: - COG: R COG2102 Predicted ATPases of PP-loop superfamily Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0678 putative 1 Conserved hypothetical protein hypothetical 04/22/01 00:00:00 terminal status:good R COG2102 General function prediction only Predicted ATPases of PP-loop superfamily

CROSS REFERENCES:
pI: 5,98
MW: 25574,18
GenBank: 13813846
SCOP superfamily: => 
SCOP assignment: 1-144 1.1e-08 Adenine nucleotide alpha hydrolases