Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0703 30S ribosomal protein S8 
MVFVNPLANALTSIYNNEMRRNKQAIIMPASKLVINVLRVMQKEGYVGEFEYIDDGRWGKITVQLLGRVNKCGPITPRYP
LSYRQMIALPDYVRRYLPSKEIGIIIVSTSKGVMSHKEAARLRIGGVALGYVY

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897609 Gene name: rps8AB COG: J COG0096 Ribosomal protein S8 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0703 hypothetical 1 rps8AB SSU ribosomal protein S8AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0096 Translation, ribosomal structure and biogenesis Ribosomal protein S8

CROSS REFERENCES:
pI: 10,8
MW: 15063,69
GenBank: 13813872
SCOP superfamily: => 
SCOP assignment: 4-133 5.0e-38 Ribosomal protein S8