Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0708 50S ribosomal protein L14 
MSEKIQVLGSRKGLTPALQHYSVVNVADNSGGKEAMIIGVYGYRGVLRRVPFANIADMVMVSIKKGTPEVRKQKFRAVIV
RQRMPYRRPDGTWISFEDNAVVIINPDGTPKGTEVRGPIAREAAERWPKIASLATLVV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897614 Gene name: rpl14AB COG: J COG0093 Ribosomal protein L14 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0708 hypothetical 1 rpl14AB LSU ribosomal protein L14AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0093 Translation, ribosomal structure and biogenesis Ribosomal protein L14

CROSS REFERENCES:
pI: 11,12
MW: 15260,74
GenBank: 13813877
SCOP superfamily: => 
SCOP assignment: 17-138 9.9e-38 Ribosomal protein L14