Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0712 30S ribosomal protein S3 
MPNIKRYFLEKSIVKVKIDEYLAKQYYNAEYAGVEVLKTPIGTRVIIYAGRPSMIIGRGGRNIKQLAQIFEKVFGLENPQ
ITITNVENPELNARVMAFRLAIALEKGYHFRRAAFISMRRIMNAGALGAEIIISGKLTTERARYEKLKEGIVYKSGQQLE
KMIDRAIAIAMLKPGIFGVEVVITKPLKIEDKINLKESPSVPQEVSVTNVTFIEESSQKSEEKSEGEKE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897617 Gene name: rps3p COG: J COG0092 Ribosomal protein S3 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0712 hypothetical 1 rps3AB SSU ribosomal protein S3AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0092 Translation, ribosomal structure and biogenesis Ribosomal protein S3

CROSS REFERENCES:
pI: 10,29
MW: 25824,98
GenBank: 13813882
SCOP superfamily: => 
SCOP assignment: 33-71 8.0e-03 KH-domain