Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0716 50S ribosomal protein L2 
MGKNLLQQRAGKGSPTFRNPGWLRIGKVRYPNIFGHFIGKVIDIVHNPGMNAPVALVKLENGTKFLMQAIQGLVVNQKIE
FGKGSPIANGNVIEIGDAPEGTIVCNVEENFGDGGKYARSAGSYAVVVGKSGDRVLIRLPSDKIKAVSNKARATVGIVAG
GGVIEKPLLKAGANYWKYKVKAKKWPIVRGVAMNVVDHPHGGGLHQSVSRPSTVSRNAPPGRKVGHIAARRTGRKEGK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897620 Gene name: rpl2AB COG: J COG0090 Ribosomal protein L2 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0716 hypothetical 1 rpl2AB LSU ribosomal protein L2AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0090 Translation, ribosomal structure and biogenesis Ribosomal protein L2

CROSS REFERENCES:
pI: 11,31
MW: 25365,43
GenBank: 13813885
SCOP superfamily: => 
SCOP assignment: 90-159 2.5e-21 Translation proteins SH3-like domain
SCOP assignment: 24-87 1.3e-13 Nucleic acid-binding proteins