Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0746 30S ribosomal protein S3a 
MSAKGGAIKDKWKMKKWYSVITPKAFGEVSLGSTPAYDITQTIGRRVETTLYDLTGDFSQVYVHLYFKIIGNEGDRLITR
FVGHELSRDYLRSLIRRKSSKINSIFDVTTKDGYVVRVKGLVLTTYKCHQSQKTAIRKIINETVSKKASELSFDDFTQEV
VFGRLANEIFEAAKKIYPLRKAEIEKTKVLKVPENLGKQVESSSVSSG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897646 Gene name: rps3AE COG: J COG1890 Ribosomal protein S3AE Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0746 putative 1 rps3AE SSU ribosomal protein S3AE Translation 1 ambiguous Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG1890 Translation, ribosomal structure and biogenesis Ribosomal protein S3AE

CROSS REFERENCES:
pI: 10,52
MW: 23541,97
GenBank: 13813913