Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO0892 Phosphoribosyl anthranilate isomerase (trpF) 
MVKLKICGNATLSDIIEFSKLDVDYLGIITDVVSQRFVKSEFLTFVKRYVEKPIVNVKVNVQISEIERELLVSDYFQIHR
VLDDSELELLKSYDFRKRIILYVPASFEYKKYLERAIDTVDMVLVDSVKKGVGVDYNVVSSFLKDYPYLGVGGKISIDNI
SNFIDLNPAWLDISSSIEIYPGKKDINMVKKIVEVVKYGSSSNK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897779 Gene name: trpF COG: E COG0135 Phosphoribosylanthranilate isomerase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO0892 confirmed 1 trpF Phosphoribosyl anthranilate isomerase Amino Acid Biosynthesis 1 single function 5.3.1.24 Aromatic amino acids 04/22/01 00:00:00 terminal status:suspect: %id E COG0135 Amino acid transport and metabolism Phosphoribosylanthranilate isomerase

CROSS REFERENCES:
pI: 6,09
MW: 23341,89
GenBank: 13814070
SCOP superfamily: => 
SCOP assignment: 1-198 1.8e-38 Ribulose-phoshate binding barrel