Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1101 Transcriptional regulator, putative 
MAEKVRFPDGREVDIHDFIAFMYGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEK
EERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQKHTALEIVI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897963 Gene name: - COG: K COG3355 Predicted transcriptional regulator Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1101 hypothetical 1 Transcriptional regulator, putative Transcription 1 single function Similarity with SSO1108 transcriptional regulator Lrs14 RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 8,99
MW: 14595,76
GenBank: 13814290
SCOP superfamily: => 
SCOP assignment: 24-99 3.9e-10 "Winged helix" DNA-binding domain