Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1213 Hydrogenase formation/expression factor related protein 
MKAIIGVGNRLMKDDGFGSCLAEVIINKVKNAVVVDLGLGNLLSVDLDKYDTVIIIDVANINEEYGIFKITSTSKGILEQ
SLHELGLNTILKLYEDKQFYIIVCKPEEIQIGYGLSKDCLLRIEKLIPEFKAFLKKLGIDADFNVMDIIEEIKERCVNTL
NK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898065 Gene name: - COG: C COG0680 Ni,Fe-hydrogenase maturation factor Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1213 putative Hydrogenase formation/expression factor related protein Energy Metabolism 1 putative Some homology to methanobacterium putative Coenzyme F420 hydrogenase delta subunit (putative coenzyme F420) 04/22/01 00:00:00 terminal status:suspect: LH C COG0680 Energy production and conversion Hydrogenase formation/expression factor HyaD/HupD

CROSS REFERENCES:
pI: 4,83
MW: 18168,15
GenBank: 13814410
SCOP superfamily: => 
SCOP assignment: 4-139 9.2e-18 Hydrogenase maturating endopeptidase HybD