Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1271 Alanyl-tRNA synthetase truncated homolog (alaS-like2) 
MDQVEIRTHTALHVVKGAVRKVLGAKWTASTYVNSNHGRLTVKFERKPSDQEMDKVFELANEKVRKNLPIIIEVLPREEA
ERKYGDEIYDLFLISAEVRELSIVVIPDWSINACNKQHTKFTSEIGEIIKDYWRYRNSKQLLEISFDIKC

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898113 Gene name: alaS-like2 COG: R COG2872 Predicted metal-dependent hydrolases related to alanyl-tRNA synthetase HxxxH domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1271 hypothetical 1 alaS-like2 Alanyl-tRNA synthetase truncated homolog Translation 1 single function Similar to other truncated alanine--tRNA ligase homologs found in Pyrococcus (PAB1440 and PH0574) Aminoacyl tRNA synthetases 04/22/01 00:00:00 terminal status:good J COG0013 Translation, ribosomal structure and biogenesis Alanyl-tRNA synthetase

CROSS REFERENCES:
pI: 8,12
MW: 17522
GenBank: 13814466
SCOP superfamily: => 
SCOP assignment: 5-128 2.7e-17 Threonyl-tRNA synthetase (ThrRS), second 'additional' domain