Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1340 Acetyl-CoA synthetase (acetate-CoA ligase) carboxy-end fragment. (acsA-2) 
MRFHPPTALRMIRKEVSSPRRDYDLRLRAVSSAGEAVGGDLIEWAMKELSPNVNEFYGCTEANLVTVNNSMWRKIGSVGK
PTPGHEIAVIDEKGNEVINQVGEIAVRIEDPVLFLGYYKNPEATAKKFRGHWFLMGDLGLMDQNGYIWFKGRGDDVIKVS
GYRLGPEEIESIILQHPAVQEVAVIGKPDRLRGNVIKAFIVLKDGYSPSDSLVEEIQQFVKSRLALYAYPREIEFVKELP
RTETGKLKRFELRKREEEKS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898181 Gene name: acsA-2 COG: I COG0365 Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1340 hypothetical 1 acsA-2b Acetyl-CoA synthetase (acetate-CoA ligase) carboxy-end fragment. Lipid metabolism 1 single function 6.2.1.1 Interrupted by transposase in ISC1316 . Amino-end is SSO1342 04/22/01 00:00:00 terminal status:check: MH I COG0365 Lipid metabolism Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases

CROSS REFERENCES:
pI: 8,39
MW: 29550,72
GenBank: 13814548
SCOP superfamily: => 
SCOP assignment: 3-259 1.3e-70 Firefly luciferase-like