Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1352 Transcriptional regulator, marR family, putative 
MQKIDEKLQLMNTIAKIYRGSIKEFNNRLGKLMNLSYLDFSILKATSEEPRSMVYLANRYFVTQSAITAAVDKLEAKGLV
RRIRDSKDRRIVIVEITPKGRQVLLEANEVLRNLVNEMLSDVENVEELLEGLNKILSRIGSSKD

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898193 Gene name: - COG: K COG1846 Transcriptional regulators Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1352 hypothetical 1 Transcriptional regulator, marR family, putative Transcription 1 single function Similarity with SlyA regulatory protein from S. typhimurium RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1846 Transcription Transcriptional regulators, MarR/EmrR family

CROSS REFERENCES:
pI: 10,18
MW: 16485,02
GenBank: 13814562
SCOP superfamily: => 
SCOP assignment: 35-106 5.2e-07 "Winged helix" DNA-binding domain