Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1357 Dolichyl-phosphate mannose synthase related protein 
MLYKYYRSSPKILLLLTCKESLKMISVIIPAFNEERRIGKTLEKISSTLPNAEVVVVFDGHDNTPEVVKKFPVKLIISKE
RLGKGMALKRGITESNFQRVLLLDADFPITEEELNKILSTDADLVIPRRKIIGMPLKRRFLHKAFIVLTKILFPSLLKFS
DFQAGVKLVNREKVVSVLDELIINDFLFDVNLIYAFKRRHYKIKEVEINYIHDESDSKISRGSVLKQS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898198 Gene name: - COG: M COG0463 Glycosyltransferases involved in cell wall biogenesis Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1357 hypothetical 1 Dolichyl-phosphate mannose synthase related protein Cell Envelope 1 single function Surface polysaccharides and lipopolysaccharides 04/22/01 00:00:00 terminal status:suspect: %id M COG0463 Cell envelope biogenesis, outer membrane Glycosyltransferases involved in cell wall biogenesis

CROSS REFERENCES:
pI: 10,42
MW: 26291,83
GenBank: 13814569
SCOP superfamily: => 
SCOP assignment: 24-223 3.2e-27 Nucleotide-diphospho-sugar transferases