Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1465 Pyrrolidone carboxylate peptidase (pcp) 
MTVLLFGFEPFLEYKENPSQLIVEALNRSTILKEEVKGVILPVEYKKIEDVIVTKIRETKPILTLGIGLAPGRAKITPEK
IAINYRYSREGDNAGKKYRGEKIDPLGQDGIFTNIPVEDLVDLLNENGIPAELSLSAGSYLCNNAMYIIIREARKYNSLG
GFIHVPLHESYAARIQRSIPSMSLDTMIRGIKLSIEFILTNKNKKENLTLS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898298 Gene name: pcp COG: O COG2039 Pyrrolidone-carboxylate peptidase (N-terminal pyroglutamyl peptidase) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1465 hypothetical 1 pcp Pyrrolidone carboxylate peptidase Proteases 1 single function 3.4.19.3 04/22/01 00:00:00 terminal status:good O COG2039 Posttranslational modification, protein turnover, chaperones Pyrrolidone-carboxylate peptidase (N-terminal pyroglutamyl peptidase)

CROSS REFERENCES:
pI: 9,04
MW: 23680,29
GenBank: 13814693
SCOP superfamily: => 
SCOP assignment: 1-206 1.2e-49 Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase)