Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO1530 Dihydrolipoamide S-acetyltransferase, carboxy-end (pdhC) 
MKITYTDILVKVVAKLLRDHPYLNATLEGDQIKIIEEVNIGIAVALDQGLIVPVIRNADTKPITEIAKESHELADKAREN
KLNPDEVSGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRRAPVVVGDNISIGYIMWLSLTFDHRVMDGHTAAKFLK
ELTEILEDENKLRTFLS

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898357 Gene name: pdhC COG: C COG0508 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO1530 hypothetical 1 pdhC Dihydrolipoamide S-acetyltransferase, carboxy-end Energy Metabolism 1 single function 2.3.1.12 Probable frameshift with SSO1529 04/22/01 00:00:00 terminal status:good C COG0508 Energy production and conversion Dihydrolipoamide acyltransferases

CROSS REFERENCES:
pI: 5,13
MW: 19665,52
GenBank: 13814762
SCOP superfamily: => 
SCOP assignment: 1-172 1.1e-66 CoA-dependent acyltransferases