Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2228 Transport protein, hypothetical 
MISGKVLRRVSIIFLFSSISLIPIFLSELIAGILFKSYVLMADSYHTLIDFLMSFIFYFTLIKINTRSKRFPWGLYNLES
LVVLTASIFIVYLSTNLILSMFDNAITLSISPWYSIILFVSSIYSLTLFLIERRYVEIQIVKNDMIHSLLDGVTEVVSGV
TLILQNTVLMDTVTLLILAFTLSDVVREIKDSIVSILGASIDSPMKFQLINELRSKNIPIINLYLKKCGSFYAVYTYIGL
PKDISLEKAYKIKRKTKRIIKKYDNIAYVDVILVPLTEIKKKKILEQVNVLYSR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899003 Gene name: - COG: P COG0053 Predicted Co/Zn/Cd cation transporters Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2228 hypothetical 1 Transport protein, hypothetical Transport 1 single function Putative Co/Zn/Cd cation transporter. Some similarity with aq_1073, aq_2073 04/22/01 00:00:00 terminal status:suspect: %id P COG0053 Inorganic ion transport and metabolism Predicted Co/Zn/Cd cation transporters

CROSS REFERENCES:
pI: 10,34
MW: 33719,93
GenBank: 13815530