Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2244 Ferric uptake regulation protein (fur) 
MEVDLANLLRQRNLKVTPQRIAILKLIMRGGHYSGEQIYEELKKTEPSISLSTVYNTLETLKESGILNSFEANGITWFEI
NRKPHVNVFCIDSNRIIDLDIEMDNFMENLTKNGLDIKNVNIIVYADCSKLGKRVE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899017 Gene name: fur COG: P COG0735 Fe2+/Zn2+ uptake regulation proteins Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2244 hypothetical 1 fur Ferric uptake regulation protein Transport 1 single function 04/22/01 00:00:00 terminal status:good P COG0735 Inorganic ion transport and metabolism Ferric uptake regulation protein

CROSS REFERENCES:
pI: 5,85
MW: 15615,85
GenBank: 13815546
SCOP superfamily: => 
SCOP assignment: 1-81 1.0e-05 "Winged helix" DNA-binding domain