Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2346 Ribosomal protein S6 modification protein (rimK-3) 
MGFISTTEQFIKRFDVLRELERNGVVLMNRPDSMLLARDKFASLMRMRRAGIPVPNTALVEDPFEVMRLAERWGEVVIKP
VVGSLGLGSVKVSDPDIAFRVAKAILSVNQPVYVQKYVKKPDRDIRVIVIGDKVLGSIYRISKSGWKTNIAQGATAQVLI
PDAELEEISLKSVRVLGLDYAGIDIIEDVENGGYKIIEVNAAPLWDGFEAATNINPAKYIVTHLIEKIRR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899102 Gene name: rimK-3 COG: HJ COG0189 Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2346 hypothetical 1 rimK-3 Ribosomal protein S6 modification protein Translation 1 single function Protein modification 04/22/01 00:00:00 terminal status:good H COG0189 Coenzyme metabolism Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase)

CROSS REFERENCES:
pI: 9,86
MW: 25646,71
GenBank: 13815645
SCOP superfamily: => 
SCOP assignment: 44-227 6.4e-39 Glutathione synthetase ATP-binding domain-like