Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2347 Transcriptional regulatory protein, AsnC family (asnC) 
MNSSFYYLDDIDKKILNILQQDSRIPFSRLAKMLNLSEATIYVRIKRLKENGVIKGFYTEIDFDKIGLSVVAFILIKADP
KKYDNILKQLVEMKEIYEIYDVTGEYYAVLKVRVPTREDLAKVLDKIGNMDGVTSTYTMLVLRSIKDKKELDL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899103 Gene name: asnC COG: K COG1522 Transcriptional regulators Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2347 hypothetical 1 asnC Transcriptional regulatory protein, AsnC family Transcription 1 single function RNA polymerase and transcription factors 04/22/01 00:00:00 terminal status:good K COG1522 Transcription Transcriptional regulators, Lrp family

CROSS REFERENCES:
pI: 9,46
MW: 17785,67
GenBank: 13815646
SCOP superfamily: => 
SCOP assignment: 6-68 2.1e-13 "Winged helix" DNA-binding domain