Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2451 GMP synthase, glutamine amidotransferase domain (guaA) 
MKVGLVYYGGQYNHLILKNVKYLGADIEVIPPHKPVEELKKFDCVIFSGGPYSVSEEIQKMGNSPLYIKELKVPMLGICL
GHQLIAYVLGGVVRRALNPEYGLTRINIFDEDTILKGFSQQLNVWESHNDEVVEPPSGFRVLASSANARVQAMANSSNSI
FGVQFHPEVKHTERGIEIFKNFLGVCRK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899196 Gene name: guaA COG: F COG0518 GMP synthase - Glutamine amidotransferase domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2451 hypothetical 1 guaA GMP synthase, glutamine amidotransferase domain Purines 1 single function 6.3.5.2 04/22/01 00:00:00 terminal status:good F COG0518 Nucleotide transport and metabolism GMP synthase - Glutamine amidotransferase domain

CROSS REFERENCES:
pI: 7,97
MW: 21035,24
GenBank: 13815754
SCOP superfamily: => 
SCOP assignment: 1-188 2.5e-44 Class I glutamine amidotransferases (GAT)