Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2462 DNA helicase related protein 
MSLELEWMSIDDLKLPSNVIDIIKNRGIKKLNPPQTEAVKKGLLDGNRLLLTSPTGSGKTLIAEMGIISFLLKNGGKAIY
VTPLRALTNEKYLTFKDWESIGFKVAMTSGDYDTDDAWLKNYDIIITTYEKLDSLWRHRPDWLNEANYFVLDELHYLNDP
ERGPVVESVTIRAKRRNLLALSATISNYKQIAKWLGAEPVATNWRPVPLMEGVMYPERKKKEYTILFRDNTARKVHGDDA
IIAYTLDSLSKNGQVLVFRNSRKMAESTALKIANYMNFVSLDEKAISEILKQLDDIEEGGSDEKELLKSLISKGVAYHHA
GLSKALRDIIEESFRKRKIKVIVATPTLAAGVNLPARTVIIGDIYRFNRKIVGYYDEIPVMEYKQMSGRAGRPGFDQIGE
SIIVVRDKEDVDRVFKKYILSDVEPIESKLGSERAFYTFLLGILSAEGSLSEKQLEAFAYESLLAKSVVDVYFDRAIRWL
SEHSFIREENNTFTLTNFGKRVADLYINPFTADIIRKGLEGYKASCEIAYLHLLAFTPDGPLVSVGRNEEEELIELLEDL
ECELLVEEPYEEDEYSLYLNALKVALIMKDWIDEVDEDTILGKYNIGSGDLRNIVETMDWLTYSAYHLSKELRLDDHSDK
LRILNLRVTDGVKEELLELVQIGGVGRKRARLLYNNGIKGLGDVVMNPDRVRNLLGQKLGERVVQEAARLLNRFH

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899206 Gene name: - COG: R COG1204 Superfamily II helicase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2462 hypothetical 1 DNA helicase related conserved protein Replication and Repair 1 single function Similar to PAB0592, PH1280, BAA32016, APE0191 04/22/01 00:00:00 terminal status:check: MH R COG1204 General function prediction only Predicted helicases

CROSS REFERENCES:
pI: 5,47
MW: 81388,52
GenBank: 13815764
SCOP superfamily: => 
SCOP assignment: 651-690 2.9e-03 Nucleotidyltransferases
SCOP assignment: 1-204 3.7e-37 P-loop containing nucleotide triphosphate hydrolases
SCOP assignment: 180-520 1.4e-14 P-loop containing nucleotide triphosphate hydrolases