Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO2487 Methylated DNA protein cysteine S-methyltransferase. (DNA 6 O methylguanine)(protein L cysteine S methyltransferase) (ogt) 
MLVYGLYKSPLGYITVAKDDKGFIMLDFCDCVEGNSRDDSSFTEFFHKLDLYFEGKPINLREPINLKTYPFRLSVFKEVM
KIPWGKVMTYKQIADSLGTSPRAVGMALSKNPILLIIPCHRVIAENGIGGYSRGVKLKRALLELEGVKIPE

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899228 Gene name: ogt COG: L COG0350 Methylated DNA-protein cysteine methyltransferase Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO2487 hypothetical 1 ogt Methylated DNA protein cysteine S-methyltransferase. (DNA 6 O methylguanine)(protein L cysteine S methyltransferase) Replication and Repair 1 single function 2.1.1.63 04/22/01 00:00:00 terminal status:good L COG0350 DNA replication, recombination and repair Methylated DNA-protein cysteine methyltransferase

CROSS REFERENCES:
pI: 9,22
MW: 17036,89
GenBank: 13815790
SCOP superfamily: => 
SCOP assignment: 70-147 3.9e-27 Methylated DNA-protein cysteine methyltransferase, C-terminal domain