Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3167 MutT-like protein 
MNISKLLQLPLTDDNESDAAVVVLIAKGQYILLIKRVSNPKDPWSGQMALPGGHRENNETAFQAAIRECEEEVGIRPNIR
SSLGVFSPNNIKIKVRAYIALLDELIEPRPNPVEVDKVFWVHESELVRGDNAFYYKQYRIWGMTYRILSKLFEIAELKI

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899871 Gene name: - COG: LR COG0494 NTP pyrophosphohydrolases including oxidative damage repair enzymes Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3167 hypothetical 1 MutT-like protein Cellular Processes 1 single function Belongs to the nudix hydrolase family Detoxification 04/22/01 00:00:00 terminal status:good F COG1051 Nucleotide transport and metabolism ADP-ribose pyrophosphatase

CROSS REFERENCES:
pI: 6,55
MW: 18197,84
GenBank: 13816598
SCOP superfamily: => 
SCOP assignment: 19-145 3.3e-22 Nucleoside triphosphate pyrophosphorylase (MutT)