Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO3205 hypothetical protein SSO3205 
MNIETLMIKNPPILSKEDRLGSAFKKINEGGIGRIIVANEKIEGLLTTRDLLSTVESYCKDSCSQGDLYHISTTPIIDYM
TPNPVTVYNTSDEFTAINIMVTRNFGSLPVVDINDKPVGIVTEREFLLLYKDLDEIFPVKVFMSTKVQTIYKEVRLDQAV
KLMLRRGFRRLPVIDDDNKVVGIVTVVNAIKQLAKAVDKLDPDYFYGKVVKDVMVTNLVTIDELASVNRAAAEMIVKRIG
SLLILNKDNTIRGIITERDLLIALHHILVMEKFKEKL

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15899907 Gene name: - COG: R COG0517 FOG: CBS domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO3205 hypothetical 1 Conserved hypothetical protein 1 single function Inosine-5'-monophosphate dehydrogenase related. Similarity with MJ1225, MTH1222, MTH1224, APE0233, Pf_336067, AF0848, PH0600, PAB0961, MJ1404, MJ1616 04/22/01 00:00:00 terminal status:good R COG0517 General function prediction only CBS domains

CROSS REFERENCES:
pI: 7,44
MW: 31257,37
GenBank: 13816643
SCOP superfamily: => 
SCOP assignment: 77-127 7.6e-10 CBS-domain
SCOP assignment: 142-195 4.1e-10 CBS-domain
SCOP assignment: 212-265 2.4e-09 CBS-domain
SCOP assignment: 6-57 5.5e-07 CBS-domain