Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO5345 elongation factor 1-beta 
MTDVLVVLKVFPDSDEVNLDNLYTDISSKLPKEYKIIRKETEPIAFGLNALILYVQMPEQTEGGTDNLEEVVNNIQGVSH
AEVVGITRLGF

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897128 Gene name: ef1B COG: J COG2092 Translation elongation factor EF-1beta Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO5345 hypothetical 1 EF1B Translation elongation factor EF-1, beta subunit Translation 1 single function Translation factors 04/22/01 00:00:00 terminal status:good J COG2092 Translation, ribosomal structure and biogenesis Translation elongation factor EF-1beta

CROSS REFERENCES:
pI: 4,2
MW: 10136,49
GenBank: 13813309
SCOP superfamily: => 
SCOP assignment: 1-89 5.9e-22 Guanine nucleotide exchange factor domain from elongation factor-1 beta