LBMGE Genomapper

Genomapper BLAST psiBLAST Mulalbla Multalin Genes & Genomes BLAST (restricted) Genome Guts COG Guess INTERPROScan CDD search Pattern search Sequence Patterns COG Trees Genome Syntenizer

Sulfolobus solfataricus P2 >SSO5866 Protein translation factor SUI1 homolog MAENLCGGLPPDICEQLSKEEQFIKIKVEKRRYGKEVTIIEGIREVMILNLKK

Supplementary options
Additional orf sequence data	See Genomic Environment
Search GenBank with PSI-Blast at NCBI	Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE	Search CDD Database at LBMGE
Determine COG functional Category (microbial)	Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base

^__________ GenBank id: 15897376 Gene name: - COG: J COG0023 Translation initiation factor 1 (eIF-1/SUI1) and related proteins Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
^__________


SSO5866
hypothetical
1

Protein translation factor SUI1 homolog
Translation
1
single function


Possibly a fragment. The protein represents only amino-end of other homologs

04/22/01 00:00:00
terminal
status:good J COG0023 Translation, ribosomal structure and biogenesis Translation initiation factor (SUI1)

CROSS REFERENCES:
pI: 10,47
MW: 5596,88
GenBank: 13813601
SCOP superfamily: => 
SCOP assignment: 8-43 1.0e-05 eIF1-like