Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6391 30S ribosomal protein S14 
MSEMGKYKPPAERKYGKGVQSCQRCGSKDSVIQKYGIYLCRQCFREVAYELGFRKYW

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897610 Gene name: rps14AB COG: J COG0199 Ribosomal protein S14 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6391 hypothetical 1 rps14AB SSU ribosomal protein S14AB Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG0199 Translation, ribosomal structure and biogenesis Ribosomal protein S14

CROSS REFERENCES:
pI: 10,13
MW: 6751,83
GenBank: 13813873