Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6663 hypothetical protein SSO6663 
MVKLRKIGEPVNAVDIILSSIALNRDMIIVTNDNDFESIKKVEERLKIEKMR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897743 Gene name: - COG: R COG1487 Predicted nucleic acid-binding protein, contains PIN domain Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6663 hypothetical 1 Hypothetical protein 1 hypothetical 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 9,25
MW: 6027,08
GenBank: 13814026