Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO6817 30S ribosomal protein S30e 
MPSHGSLTKAGKVRSQTPKIQPKEKHKEVPRVRNRKEYEKRVVKARQQAPAR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897819 Gene name: rps30E COG: J COG4919 Ribosomal protein S30 Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO6817 hypothetical 1 rps30E LSU ribosomal protein S30E Translation 1 single function Homologous to APES068 Ribosomal Proteins 04/22/01 00:00:00 terminal status: no hit

CROSS REFERENCES:
pI: 11,98
MW: 6046,06
GenBank: 13814118