Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO7114 30S ribosomal protein S27 
MMRKLRVLIPEPKSRFLRVKCPNCGNEQTIFSHATFPVRCLSCGTELVYSMGGKAKIVGEVVRIMG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15897918 Gene name: rps27E COG: J COG2051 Ribosomal protein S27E Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO7114 hypothetical 1 rps27E SSU ribosomal protein S27E Translation 1 single function Ribosomal Proteins 04/22/01 00:00:00 terminal status:good J COG2051 Translation, ribosomal structure and biogenesis Ribosomal protein S27E

CROSS REFERENCES:
pI: 10,51
MW: 7384,86
GenBank: 13814235