Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Sulfolobus solfataricus P2
>SSO9500 hypothetical protein SSO9500 
MSQEVRIAKTLDARGMYCPGPVLETAKAIKQINVGEVLEILATDPAAKPDIEAWARRTGNQVVDIQQQGGVTRILIKRMK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
Go to S. solfataricus P2 Data Base
__________ GenBank id: 15898806 Gene name: - COG: O COG0425 Predicted redox protein, regulator of disulfide bond formation Taxon: 273057 Lineage: Archaea: TACK group: Crenarchaeota: Thermoprotei: Sulfolobales: Sulfolobaceae: Sulfolobus: Sulfolobus solfataricus: Sulfolobus solfataricus P2
__________

 


SSO9500 hypothetical 1 Conserved hypothetical protein 1 single function Multicopy (SSO8861,SSO7239).Similar to AF0556, Ta1414, Ta1170, AF0188,TM0983, MJ0990. Contains uncharacterized protein family UPF0033 signature 04/22/01 00:00:00 terminal status:good K COG0425 Transcription Predicted transcriptional regulators

CROSS REFERENCES:
pI: 10,05
MW: 8801,25
GenBank: 13815293