Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Pyrococcus abyssi
>PABs5591 thiS sulfur transfer protein involved in thiamine biosynthesis (was: pab1622a)
MEVIKVKVIGRGIEKEIEWREGMKVKDVLRAVGFNTESAIAKVNGKVALEDKEVKDGDFVEVIPVVSGG

Supplementary options
Additional orf sequencg dat`<'a> See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
See this orf in P. abyssi Data Base
__________ GenBank id: 100000106790 Gene name: - COG: Taxon: 272844 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Pyrococcus: Pyrococcus abyssi: Pyrococcus abyssi GE5
__________