Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Kluyveromyces lactis Chromosome V
>r_klactV1966 693607 693485 -41
MIPPLSGFTCRLSILLVSINKSVVLFSIFRTCTIKRELRTV

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 100000067478 Gene name: - COG: Taxon: 284590 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Kluyveromyces: Kluyveromyces lactis: Kluyveromyces lactis NRRL Y-1140
__________