Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees
Pyrococcus abyssi
>PAB7387 rpl31E LSU ribosomal protein L31E
MPIKPGEEVIFTVPIRKIKKIVPRWKRAPRAVKFVREFVARHAKAQEVIISTKVNEKIWERGIEKPPSRLRVKVKVEEED
RDGKKVRIAYVDLA

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
See this orf in P. abyssi Data Base
__________ GenBank id: 14521719 Gene name: rpl31E COG: J COG2097 Ribosomal protein L31E Taxon: 272844 Lineage: Archaea: Euryarchaeota: Thermococci: Thermococcales: Thermococcaceae: Pyrococcus: Pyrococcus abyssi: Pyrococcus abyssi GE5
__________